Home / Services / Peptide Synthesis / Cosmetic Peptides

Our Peptide Synthesis

Cosmetic Peptides

The increasing popularity of peptides due to their diverse cosmetic properties has led to a rise in demand for peptides as key ingredients in the cosmetic industry.

Bio Basic has the capability to synthesize peptides related to the cosmetic industry (note: research related; not for human use), with high batch to batch consistency and scalability to meet your exact specifications required.

Synthesis of crude to high purity peptides (>98%).

mg to kg quantities available.

Option of aliquoting into single or multiple vials/tubes.

HPLC and MS data provided. Additional QC data available upon request.

Solubility Testing and TFA Removal available upon request.

Price List: Click here.

Modifications List: Click here.

Turnaround: 2-3 weeks (varies with peptide length and complexity).

Catalogue Cosmetic Peptides

(More peptides available than listed below. Please inquire at peptide@biobasic.com; Peptides are for research use only).
Pricing subject to change. Pricing displayed below is for budgeting purposes only. Please inquire for more accurate pricing.


Name

CAS

Sequence

Purity
Acetyl Hexapeptide-3 (Argreline Acetate) 616204-22-9 (Ac)-EEMQRR-[NH2] 98%
Acetyl Tetrapeptide-15 928007-64-1 YPFF 98%
Acetyl Tetrapeptide-2 757942-88-4 (Ac)-KDVY 98%
Acetyl Tetrapeptide-5 820959-17-9 (Ac)-AHSH 98%
Acetyl-Decapeptide-3 - (Ac)-YRSRKYTSWY-[NH2] 98%
Ac-KGHK 827306-88-7 (Ac)-KGHK 98%
Ac-KGHK-NH2 - (Ac)-KGHK-[NH2] 98%
AHK-Cu - (AHK)2.Cu 98%
Argireline (Acetyl-Hexapeptide-8) 616204-22-9 (Ac)-EEMQRR-[NH2] 98%
Biotinoyl Tripeptide-1 (Biotin-GHK) 299157-54-3 (Biotin)-GHK 98%
Capsaicin 404-86-4 - -
Carnosine 305-84-0 [Beta]-AH 98%
Copper peptide (GHK-Cu) - GHK.Cu 98%
Copper Tripeptide-1 (GHK-Cu) 89030-95-5 (GHK)2.Cu 98%
Copper Tripeptide-3 - AHK.Cu 98%
Cysteine peptide (Ac-RFAACAA-OH) - (Ac)-RFAACAA-[OH] 98%
Decapeptide-12 - [H]-YRSRKYSSWY-[OH] 98%
Dipeptide-2 24587-37-9 VW 98%
Epidermal Growth Factor (EGF), Human 62253-63-8 Refer to Cat. # RC216-15 >98%
Fibroblast Growth Factor-basic (FGF-basic), Human - Refer to Cat. # RC215-13 >96%
GHK - GHK.HCl 98%
Hexapeptide-11 100684-36-4 FVAPFP 98%
Hexapeptide-12 - VGVAPG 98%
Hexapeptide-2 (Nonapeptide-1) - MP(dF)R(dW)FKPV-[CONH2] 98%
Hexapeptide-9 1228371-11-6 GPQGPQ 98%
HGG - HGG 98%
Kyotorphin - YR 98%
LL37, Human - [LL-37, 37 aa] 98%
Lysine peptide (Ac-RFAAKAA-OH) - (Ac)-RFAAKAA-[OH] 98%
LZ1 peptide - VKRWKKWWRKWKKWV-[NH2] 98%
LZ1 peptide - VKRWKKWWRKWKKWV-[NH2] 98%
N-Acetyl Carnosine - (Ac)-[Beta]-AH-[OH] 98%
Octapeptide-2 - TAEEHEVM-(CONH2) 98%
Oligopeptide-20 - [H]-CRKIPNGYDTL-[OH] 98%
Oligopeptide-20, Human 124861-55-8 - 98%
Pal-GQPR 221227-05-0 (Pal)-GQPR 98%
Pal-KTTK - (Pal)-KTTK 98%
Pal-KV-Dab-T-OH - (Pal)-KV-(Dab)-T-[OH] 98%
Palmiotyl Tripeptide-5 (Pal-KVK) 623172-55-4 (Pal)-KVK-[OH] 98%
Palmitoyl Hexapeptide 171263-26-6 (Pal)-VGVAPG 98%
Palmitoyl Pentapeptide (PAL-KTTKS) 214047-00-4 (Pal)-KTTKS 98%
Palmitoyl-Carnosine - (Pal)-Carnosine 98%
Palmitoyl-Dipeptide-6 - (Pal)-KV-(Dab)-T-[OH] 98%
147732-56-7 (Pal)-GHK 98%
Palmitoyl Tetrapeptide-3 (Pal-GQPR) - (Pal)-GQPR 98%
Palmitoyl-Tripeptide - (Pal)-RFK 98%
Palmitoyl-Tripeptide-3 - (Pal)-AHK 98%
Pentapeptide-18 (Leuphasyl) 64963-01-5 [H]-Y-[D-Ala]-GFL-[OH] 98%
Pentapeptide-3 (Vialox) 725232-44-0 [H]-GPRPA-[NH2] 98%
Peptide CK - RKR 98%
Peptide CK+ - (Ac)-RKR-[NH2] 98%
Peptide E - RSRK 98%
RKR - RKR 98%
SIKVAV 146439-94-3 SIKVAV 98%
Snake trippetide (Dipeptide Diaminobutyroyl
Benzylamide Diacetate)
823202-99-9 [Beta]-AP-(Dab)-[NH]-(Bzl).2AcOH 98%
Snap-8  (Acetyl Glutamyl Octapeptide-3) 868844-74-0 (Ac)-EEMQRRAD-[NH2] 98%
Tripeptide-1 - [H]-GHK-[OH] 98%
Tripeptide-3 725232-44-0 AHK.HCl 98%

(More peptides available than listed above. Please inquire at peptide@biobasic.com; Peptides are for research use only).
Pricing subject to change. Pricing displayed below is for budgeting purposes only. Please inquire for more accurate pricing.

SAVE with our Bimonthly newsletter

opt-out anytime
Contact us

20 Konrad Crescent, Markham ON, Canada, L3R 8T4 | 4160 Bailey Avenue, Amherst, NY, USA, 14226 | Copyright © 2017 Bio Basic Inc. All rights reserved