Home / FGF-basic, Fibroblast Growth Factor-basic, human

FGF-basic, Fibroblast Growth Factor-basic, human

Cat.#: RC215-13
FGF-basic, Fibroblast Growth Factor-basic, human

More Views

Size:
RC215-13 (10ug)
RC215-13 (50ug)
RC215-13 (1mg)
Quantity:
DG: No
Storage: (-15 to -20)C
Sterile: Yes
Stock: Inquire
US$64.43

US$64.43
Add Favourite

Unsure about this product? Request a Free Sample* at: order@biobasic.com

More Info
Product Description: FGF-basic, Fibroblast Growth Factor-basic, human: Human Fibroblast Growth Factor-basic
FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35 - 60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21 - 24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH-3T3 cells.
Recombinant Human Fibroblast Growth Factor-basic (rHuFGF-2 )
Source: Escherichia coli.
Molecular Weight:
Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 155 amino acids.
Quantity: 10ug/50ug/1000µg
Purity: >96% by SDS-PAGE and HPLC analyses.
Biological Activity: Fully biologically active when compared to standard. The ED50, calculated by the dose- dependant proliferation of BAF3 cells expressing FGF receptors (measured by 3H- thymidine uptake) is <0.5 ng/ml, corresponding to a specific activity of 2.0 x 106 Units/mg.
Formulation: Lyophilized from a 0.2mm filtered concentrated (1mg/ml) solution in PBS, pH 7.4.
AA Sequence: MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVV SIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSK TGPGQKAILFLPMSAKS
Endotoxin level: Less than 1EU/mg of rHubFGF as determined by LAL method.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
, Accession number: NM_002006, UnitProt ID: P09038
Total Product Size:
RC215-13 (10ug)
RC215-13 (50ug)
RC215-13 (1mg)
Number of Containers: 1
Refrigeration Requirements: Freezer
Shipping Conditions: ICE
UNSPSC Code: 41116127
UNSPSC Category: Other Cytokines and Chemokines
Documents
Support
  • Technical Inquries:

    For product support/troubleshooting,
    please email us your inquiry at:
    tech@biobasic.com

SAVE with our Bimonthly newsletter

opt-out anytime
Contact us

20 Konrad Crescent, Markham ON, Canada, L3R 8T4 | 4160 Bailey Avenue, Amherst, NY, USA, 14226 | Copyright © 2017 Bio Basic Inc. All rights reserved