Due to the high selectivity and efficacy of peptides in drug development, there is an increased interest in peptides in pharmaceutical research and development.
Bio Basic has the capacity to synthesize hundreds of pharmaceutical grade peptides with GMP equivalent standards and high batch to batch consistency to meet your exact specifications required.
Synthesis of crude to high purity peptides (>98%).
mg to kg quantities available.
Option of aliquoting into single or multiple vials/tubes.
HPLC and MS data provided. Additional QC data available upon request.
Solubility Testing and TFA Removal available upon request.
Price List: Click here.
Modifications List: Click here.
Turnaround: 2-3 weeks (varies with peptide length and complexity).

Catalogue Pharmaceutical Peptides
(More peptides available than listed below. Pricing subject to change. Please inquire at peptide@biobasic.com).
Name |
CAS |
Sequence |
Purity |
Quantity |
Price |
|---|---|---|---|---|---|
| Octreotide Acetate | 79517-01-4 | fCFwKTCT-(Ol) (Disulfide bridge:C2-C7) | 98% | 1g | $450.88 |
| Thymosin a1 Acetate | 62304-98-7 | (Ac)-SDAAVDTSSEITTKDLKEKKEVVEEAEN | 95% | 1g | $12,104.12 |
| Leuprorelin Acetate | 74381-53-6 | (Pyr)-HWSYlLRPNH-(Et) | 98% | 1g | $462.91 |
| Enfuvirtide; T-20 | 159519-65-0 | (Ac)-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2 | 95% | 1g | $2,404.71 |
| Eptifibatide | 188627-80-7 | (Mpa)-(Har)-GDWPC-NH2 (Disulfide bridge: Mpa1-C6) | 98% | 1g | $514.06 |
| Secretin Acetate ,porcine | 17034-35-4 | HSDGTFTSELSRLRDSARLQRLLQGLV-NH2 | 98% | 1g | $2,404.71 |
| Angiotensin Acetate | 58-49-1 | DRVYVHPF | 98% | 1g | $360.71 |
| Nesiritide Acetate (BNP-32) | 114471-18-0 | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: C10-C26) | 95% | 1g | $2,855.60 |
| Teriparatide Acetate | 99294-94-7 | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF | 95% | 1g | $2,404.71 |
| Sincalide (CCK-8) | 25126-32-3 | DY(SO3H)MGWMDF-NH2 | inquire | inquire | inquire |
| Alarelin Acetate | 79561-22-1 | (Pyr)-HWSYaLRPNH-(Et) | 98% | 1g | $450.88 |
| Gonadorelin Acetate | 34973-08-5 | (Pyr)-HWSYGLRPG-NH2 | 98% | 1g | $360.71 |
| Goserelin Acetate | 145781-92-6 | (Pyr)-HWSYs-(tBu)-LRP-(AzaG)-NH2 | inquire | inquire | inquire |
| Salmon Calcitonin Acetate | 47931-85-1 | c[CSNLSTC]VLGKLSQELHKLQTYPRTNTGSGTP-NH2 | 98% | 1g | $2,855.60 |
| Argipressin Acetate | 113-79-1 | CYFQNCPRGNH2 (Disulfide bridge: C1-C6) | 98% | 1g | $480.94 |
| Lypressin Acetate | 50-57-7 | CYFQNCPKG-NH2 (Disulfide bridge: C1-C6) | 98% | 1g | $450.88 |
| Ornipressin Acetate | 3397-23-7 | c[CYFQNC]P-(Orn)-G-NH2 | 98% | 1g | $480.94 |
| Atosiban Acetate | 90779-69-4 | (Mpa)-y-(ET)-ITNCP-(Orn)-G-NH2 (Disulfide bridge: Mpa1-C6) | inquire | inquire | inquire |
| Desmopressin Acetate (DDAVP) | 34973-08-5 | (Mpr)YFQNCPrG-NH2 (Disulfide bridge: Mpr1-C6) | 98% | 1g | $661.30 |
| Somatostatin Acetate | 38916-34-6 | AG-c[CKNFFWKTFTSC] | 98% | 1g | $541.06 |
| Terlipressin Acetate | 14636-12-5 | GGGCYFQNCPKG-NH2 (Disulfide bridge: C4-C9) | 98% | 1g | $480.94 |
| Elcatonin Acetate | 60731-46-6 | SNLST-(Asu)-VLGKLSQELHKLQTYPRTDVGAGTP (Lactam bridge: S1-Asu6) | inquire | inquire | inquire |
| Deslorelin Acetate | 57773-65-6 | (Pyr)-HWSYwLRPNH-(Et) | 98% | 1g | $390.77 |
| Histrelin Acetate | 76712-82-8 | (Pyr)-HWSYh-(Bzl)-LRPNH-(Et) | inquire | inquire | inquire |
| Antide Acetate | 112568-12-4 | (Ac)-(D2Nal)-(pChloro-f)-[beta](3pyridyl)-aSK(nicotinoyl)k(nicotinoyl)LK(isopropyl)Pa-NH2 | inquire | inquire | inquire |
| Cetrorelix Acetate | 130143-01-0 | (Ac)-3-(2-naphthyl)-a-(4-Chloro-f)-3-(3-pyridyl)-aSYD-(Cit)-LRPa-NH2 | 98% | 1g | $2,104.12 |
| Carbetocin Acetate | 37025-55-1 | (Butyryl)-Y-(Me)-IQNCPLG-NH2 (Sulfide bond between Butyryl-4-yl and C) | inquire | inquire | inquire |
order@biobasic.com
1 (905) 474‐4493
1 (800) 313‐7224
1 (905) 474‐5794