Home / G-CSF, Granulocyte Colony Stimulating Factor, monkey (rhesus macaque)

G-CSF, Granulocyte Colony Stimulating Factor, monkey (rhesus macaque)

Cat.#: RC223-13
G-CSF, Granulocyte Colony Stimulating Factor, monkey (rhesus macaque)

More Views

Size:
RC223-13 (2ug)
RC223-13 (10ug)
RC223-13 (1mg)
Quantity:
DG: No
Storage: (-15 to -20)C
Sterile: Yes
Stock: Inquire
$163.71

$163.71
Add Favourite

Unsure about this product? Request a Free Sample* at: order@biobasic.com

More Info
Product Description: G-CSF, Granulocyte Colony Stimulating Factor, monkey (rhesus macaque): Rhesus macaque Granulocyte Colony Stimulating Factor
GCSF is a pleiotropic cytokine best known for its specific effects on the proliferation, differentiation, and activation of hematopoietic cells of the neutrophilic granulocyte lineage. It is produced mainly by monocytes and macrophages upon activation by endotoxin, TNFα and IFNγ. Other cell types including fibroblasts, endothelial cells, astrocytes and bone marrow stromal cells can also secrete GCSF after LPS, IL1 or TNFα activation. In addition, various carcinoma cell lines and myeloblastic leukemia cells can express GCSF constitutively.
Source: Escherichia coli.
Molecular Weight: Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids.
Quantity: 2ug/10ug/1mg
AASequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEEL VLLRHSLGIP WAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDT LQLDIADFAT TIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRF LELAYRVLR HLAQS
Purity: >98% by SDS-PAGE and HPLC analyses.
Biological Activity: The ED50 as calculated by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than 0.1 ng/ml, corresponding to a Specific Activity of 1.0×107 IU/mg.
Formulation: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Endotoxin: Less than 1EU/mg of rRhG-CSF as determined by LAL method.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions
, Accession number: XM_001095097, UnitProt ID: F7H1Q6-1
Total Product Size:
RC223-13 (2ug)
RC223-13 (10ug)
RC223-13 (1mg)
Number of Containers: 1
Refrigeration Requirements: Freezer
Shipping Conditions: ICE
UNSPSC Code: 41116127
UNSPSC Category: Other Cytokines and Chemokines
Documents
Support
  • Technical Inquries:

    For product support/troubleshooting,
    please email us your inquiry at:
    tech@biobasic.com

SAVE with our Bimonthly newsletter

opt-out anytime
Contact us

20 Konrad Crescent, Markham ON, Canada, L3R 8T4 | 4160 Bailey Avenue, Amherst, NY, USA, 14226 | Copyright © 2017 Bio Basic Inc. All rights reserved