Home / Services / Peptide Synthesis / Cosmetic Peptides

Our Peptide Synthesis

Cosmetic Peptides

The increasing popularity of peptides due to their diverse cosmetic properties has led to a rise in demand for peptides as key ingredients in the cosmetic industry.

Bio Basic has the capability to synthesize peptides related to the cosmetic industry (note: research related; not for human use), with high batch to batch consistency and scalability to meet your exact specifications required.

Synthesis of crude to high purity peptides (>98%).

mg to kg quantities available.

Option of aliquoting into single or multiple vials/tubes.

HPLC and MS data provided. Additional QC data available upon request.

Solubility Testing and TFA Removal available upon request.

Price List: Click here.

Modifications List: Click here.

Turnaround: 2-3 weeks (varies with peptide length and complexity).

Catalogue Cosmetic Peptides

(More peptides available than listed below. Please inquire at peptide@biobasic.com; Peptides are for research use only).
Pricing subject to change. Pricing displayed below is for budgeting purposes only. Please inquire for more accurate pricing.


Name

CAS

Sequence

Purity

Quantity

Price
Acetyl Hexapeptide-3 (Argreline Acetate) 616204-22-9 (Ac)-EEMQRR-[NH2] 98% 1000 mg $120.00
Acetyl Tetrapeptide-15 928007-64-1 YPFF 98% 1000 mg $180.00
Acetyl Tetrapeptide-2 757942-88-4 (Ac)-KDVY 98% 1000 mg $180.00
Acetyl Tetrapeptide-5 820959-17-9 (Ac)-AHSH 98% 1000 mg $180.00
Acetyl-Decapeptide-3 - (Ac)-YRSRKYTSWY-[NH2] 98% 1000 mg $360.00
Ac-KGHK 827306-88-7 (Ac)-KGHK 98% 1000 mg $210.00
Ac-KGHK-NH2 - (Ac)-KGHK-[NH2] 98% 1000 mg $210.00
AHK-Cu - (AHK)2.Cu 98% 1000 mg $300.00
Argireline (Acetyl-Hexapeptide-8) 616204-22-9 (Ac)-EEMQRR-[NH2] 98% 1000 mg $120.00
Biotinoyl Tripeptide-1 (Biotin-GHK) 299157-54-3 (Biotin)-GHK 98% 1000 mg $180.00
Capsaicin 404-86-4 - - 1000 mg inquire
Carnosine 305-84-0 [Beta]-AH 98% 1000 mg $300.00
Copper peptide (GHK-Cu) - GHK.Cu 98% 1000 mg $300.00
Copper Tripeptide-1 (GHK-Cu) 89030-95-5 (GHK)2.Cu 98% 1000 mg $300.00
Copper Tripeptide-3 - AHK.Cu 98% 1000 mg $300.00
Cysteine peptide (Ac-RFAACAA-OH) - (Ac)-RFAACAA-[OH] 98% 1000 mg $210.00
Decapeptide-12 - [H]-YRSRKYSSWY-[OH] 98% 1000 mg $240.00
Dipeptide-2 24587-37-9 VW 98% 1000 mg $240.00
Epidermal Growth Factor (EGF), Human 62253-63-8 Refer to Cat. # RC216-15 >98% RC216-15 RC216-15
Fibroblast Growth Factor-basic (FGF-basic), Human - Refer to Cat. # RC215-13 >96% RC215-13 RC215-13
GHK - GHK.HCl 98% 1000 mg $120.00
Hexapeptide-11 100684-36-4 FVAPFP 98% 1000 mg $180.00
Hexapeptide-12 - VGVAPG 98% 1000 mg $180.00
Hexapeptide-2 (Nonapeptide-1) - MP(dF)R(dW)FKPV-[CONH2] 98% 1000 mg $360.00
Hexapeptide-9 1228371-11-6 GPQGPQ 98% 1000 mg $180.00
HGG - HGG 98% 1000 mg $150.00
Kyotorphin - YR 98% 1000 mg $240.00
LL37, Human - [LL-37, 37 aa] 98% 1000 mg $2100.00
Lysine peptide (Ac-RFAAKAA-OH) - (Ac)-RFAAKAA-[OH] 98% 1000 mg $165.00
LZ1 peptide - VKRWKKWWRKWKKWV-[NH2] 98% 1000 mg $540.00
LZ1 peptide - VKRWKKWWRKWKKWV-[NH2] 98% 1000 mg $540.00
N-Acetyl Carnosine - (Ac)-[Beta]-AH-[OH] 98% 1000 mg $180.00
Octapeptide-2 - TAEEHEVM-(CONH2) 98% 1000 mg $210.00
Oligopeptide-20 - [H]-CRKIPNGYDTL-[OH] 98% 1000 mg $240.00
Oligopeptide-20, Human 124861-55-8 - 98% 1000 mg $180.00
Pal-GQPR 221227-05-0 (Pal)-GQPR 98% 1000 mg $180.00
Pal-KTTK - (Pal)-KTTK 98% 1000 mg $210.00
Pal-KV-Dab-T-OH - (Pal)-KV-(Dab)-T-[OH] 98% 1000 mg $210.00
Palmiotyl Tripeptide-5 (Pal-KVK) 623172-55-4 (Pal)-KVK-[OH] 98% 1000 mg $120.00
Palmitoyl Hexapeptide 171263-26-6 (Pal)-VGVAPG 98% 1000 mg $180.00
Palmitoyl Pentapeptide (PAL-KTTKS) 214047-00-4 (Pal)-KTTKS 98% 1000 mg $120.00
Palmitoyl-Carnosine - (Pal)-Carnosine 98% 1000 mg $330.00
Palmitoyl-Dipeptide-6 - (Pal)-KV-(Dab)-T-[OH] 98% 1000 mg $270.00
147732-56-7 (Pal)-GHK 98% 1000 mg $120.00
Palmitoyl Tetrapeptide-3 (Pal-GQPR) - (Pal)-GQPR 98% 1000 mg $120.00
Palmitoyl-Tripeptide - (Pal)-RFK 98% 1000 mg $180.00
Palmitoyl-Tripeptide-3 - (Pal)-AHK 98% 1000 mg $180.00
Pentapeptide-18 (Leuphasyl) 64963-01-5 [H]-Y-[D-Ala]-GFL-[OH] 98% 1000 mg $210.00
Pentapeptide-3 (Vialox) 725232-44-0 [H]-GPRPA-[NH2] 98% 1000 mg $180.00
Peptide CK - RKR 98% 1000 mg $180.00
Peptide CK+ - (Ac)-RKR-[NH2] 98% 1000 mg $210.00
Peptide E - RSRK 98% 1000 mg $180.00
RKR - RKR 98% 1000 mg $180.00
SIKVAV 146439-94-3 SIKVAV 98% 1000 mg $180.00
Snake trippetide (Dipeptide Diaminobutyroyl
Benzylamide Diacetate)
823202-99-9 [Beta]-AP-(Dab)-[NH]-(Bzl).2AcOH 98% 1000 mg $900.00
Snap-8  (Acetyl Glutamyl Octapeptide-3) 868844-74-0 (Ac)-EEMQRRAD-[NH2] 98% 1000 mg $180.00
Tripeptide-1 - [H]-GHK-[OH] 98% 1000 mg $120.00
Tripeptide-3 725232-44-0 AHK.HCl 98% 1000 mg $180.00

(More peptides available than listed above. Please inquire at peptide@biobasic.com; Peptides are for research use only).
Pricing subject to change. Pricing displayed below is for budgeting purposes only. Please inquire for more accurate pricing.

SAVE with our Bimonthly newsletter

opt-out anytime
Contact us

20 Konrad Crescent, Markham ON, Canada, L3R 8T4 | 4160 Bailey Avenue, Amherst, NY, USA, 14226 | Copyright © 2017 Bio Basic Inc. All rights reserved