car
Home / Services / Peptide Synthesis / Pharmaceutical Peptides

Our Peptide Synthesis

Pharmaceutical Peptides

Due to the high selectivity and efficacy of peptides in drug development, there is an increased interest in peptides in pharmaceutical research and development.

Bio Basic has the capacity to synthesize hundreds of pharmaceutical grade peptides with GMP equivalent standards and high batch to batch consistency to meet your exact specifications required.

Synthesis of crude to high purity peptides (>98%).

mg to kg quantities available.

Option of aliquoting into single or multiple vials/tubes.

HPLC and MS data provided. Additional QC data available upon request.

Solubility Testing and TFA Removal available upon request.

Price List: Click here.

Modifications List: Click here.

Turnaround: 2-3 weeks (varies with peptide length and complexity).

Catalogue Pharmaceutical Peptides

(More peptides available than listed below. Pricing subject to change. Please inquire at peptide@biobasic.com).


Name

CAS

Sequence

Purity

Quantity

Price
Octreotide Acetate 79517-01-4 fCFwKTCT-(Ol) (Disulfide bridge:C2-C7) 98% 1g $450.88
Thymosin a1 Acetate 62304-98-7 (Ac)-SDAAVDTSSEITTKDLKEKKEVVEEAEN 95% 1g $12,104.12
Leuprorelin Acetate 74381-53-6 (Pyr)-HWSYlLRPNH-(Et) 98% 1g $462.91
Enfuvirtide; T-20 159519-65-0 (Ac)-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2 95% 1g $2,404.71
Eptifibatide 188627-80-7 (Mpa)-(Har)-GDWPC-NH2 (Disulfide bridge: Mpa1-C6) 98% 1g $514.06
Secretin Acetate ,porcine 17034-35-4 HSDGTFTSELSRLRDSARLQRLLQGLV-NH2 98% 1g $2,404.71
Angiotensin Acetate 58-49-1 DRVYVHPF 98% 1g $360.71
Nesiritide Acetate (BNP-32) 114471-18-0 SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: C10-C26) 95% 1g $2,855.60
Teriparatide Acetate 99294-94-7 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF 95% 1g $2,404.71
Sincalide (CCK-8) 25126-32-3 DY(SO3H)MGWMDF-NH2 inquire inquire inquire
Alarelin Acetate 79561-22-1 (Pyr)-HWSYaLRPNH-(Et) 98% 1g $450.88
Gonadorelin Acetate 34973-08-5 (Pyr)-HWSYGLRPG-NH2 98% 1g $360.71
Goserelin Acetate 145781-92-6 (Pyr)-HWSYs-(tBu)-LRP-(AzaG)-NH2 inquire inquire inquire
Salmon Calcitonin Acetate 47931-85-1 c[CSNLSTC]VLGKLSQELHKLQTYPRTNTGSGTP-NH2 98% 1g $2,855.60
Argipressin Acetate 113-79-1 CYFQNCPRGNH2 (Disulfide bridge: C1-C6) 98% 1g $480.94
Lypressin Acetate 50-57-7 CYFQNCPKG-NH2 (Disulfide bridge: C1-C6) 98% 1g $450.88
Ornipressin Acetate 3397-23-7 c[CYFQNC]P-(Orn)-G-NH2 98% 1g $480.94
Atosiban Acetate 90779-69-4 (Mpa)-y-(ET)-ITNCP-(Orn)-G-NH2 (Disulfide bridge: Mpa1-C6) inquire inquire inquire
Desmopressin Acetate (DDAVP) 34973-08-5 (Mpr)YFQNCPrG-NH2 (Disulfide bridge: Mpr1-C6) 98% 1g $661.30
Somatostatin Acetate 38916-34-6 AG-c[CKNFFWKTFTSC] 98% 1g $541.06
Terlipressin Acetate 14636-12-5 GGGCYFQNCPKG-NH2 (Disulfide bridge: C4-C9) 98% 1g $480.94
Elcatonin Acetate 60731-46-6 SNLST-(Asu)-VLGKLSQELHKLQTYPRTDVGAGTP (Lactam bridge: S1-Asu6) inquire inquire inquire
Deslorelin Acetate 57773-65-6 (Pyr)-HWSYwLRPNH-(Et) 98% 1g $390.77
Histrelin Acetate 76712-82-8 (Pyr)-HWSYh-(Bzl)-LRPNH-(Et) inquire inquire inquire
Antide Acetate 112568-12-4 (Ac)-(D2Nal)-(pChloro-f)-[beta](3pyridyl)-aSK(nicotinoyl)k(nicotinoyl)LK(isopropyl)Pa-NH2 inquire inquire inquire
Cetrorelix Acetate 130143-01-0 (Ac)-3-(2-naphthyl)-a-(4-Chloro-f)-3-(3-pyridyl)-aSYD-(Cit)-LRPa-NH2 98% 1g $2,104.12
Carbetocin Acetate 37025-55-1 (Butyryl)-Y-(Me)-IQNCPLG-NH2 (Sulfide bond between Butyryl-4-yl and C) inquire inquire inquire
SAVE with our Bimonthly newsletter

opt-out anytime
Contact us

20 Konrad Crescent, Markham ON, Canada, L3R 8T4 | 4160 Bailey Avenue, Amherst, NY, USA, 14226 | Copyright © 2017 Bio Basic Inc. All rights reserved