The increasing popularity of peptides due to their diverse cosmetic properties has led to a rise in demand for peptides as key ingredients in the cosmetic industry.
Bio Basic has the capability to synthesize peptides related to the cosmetic industry (note: research related; not for human use), with high batch to batch consistency and scalability to meet your exact specifications required.
Synthesis of crude to high purity peptides (>98%).
mg to kg quantities available.
Option of aliquoting into single or multiple vials/tubes.
HPLC and MS data provided. Additional QC data available upon request.
Solubility Testing and TFA Removal available upon request.
Price List: Click here.
Modifications List: Click here.
Turnaround: 2-3 weeks (varies with peptide length and complexity).
Catalogue Cosmetic Peptides
(More peptides available than listed below. Please inquire at peptide@biobasic.com; Peptides are for research use only).
Pricing subject to change. Pricing displayed below is for budgeting purposes only. Please inquire for more accurate pricing.
Name |
CAS |
Sequence |
Purity |
---|---|---|---|
Acetyl Hexapeptide-3 (Argreline Acetate) | 616204-22-9 | (Ac)-EEMQRR-[NH2] | 98% |
Acetyl Tetrapeptide-15 | 928007-64-1 | YPFF | 98% |
Acetyl Tetrapeptide-2 | 757942-88-4 | (Ac)-KDVY | 98% |
Acetyl Tetrapeptide-5 | 820959-17-9 | (Ac)-AHSH | 98% |
Acetyl-Decapeptide-3 | - | (Ac)-YRSRKYTSWY-[NH2] | 98% |
Ac-KGHK | 827306-88-7 | (Ac)-KGHK | 98% |
Ac-KGHK-NH2 | - | (Ac)-KGHK-[NH2] | 98% |
AHK-Cu | - | (AHK)2.Cu | 98% |
Argireline (Acetyl-Hexapeptide-8) | 616204-22-9 | (Ac)-EEMQRR-[NH2] | 98% |
Biotinoyl Tripeptide-1 (Biotin-GHK) | 299157-54-3 | (Biotin)-GHK | 98% |
Capsaicin | 404-86-4 | - | - |
Carnosine | 305-84-0 | [Beta]-AH | 98% |
Copper peptide (GHK-Cu) | - | GHK.Cu | 98% |
Copper Tripeptide-1 (GHK-Cu) | 89030-95-5 | (GHK)2.Cu | 98% |
Copper Tripeptide-3 | - | AHK.Cu | 98% |
Cysteine peptide (Ac-RFAACAA-OH) | - | (Ac)-RFAACAA-[OH] | 98% |
Decapeptide-12 | - | [H]-YRSRKYSSWY-[OH] | 98% |
Dipeptide-2 | 24587-37-9 | VW | 98% |
Epidermal Growth Factor (EGF), Human | 62253-63-8 | Refer to Cat. # RC216-15 | >98% |
Fibroblast Growth Factor-basic (FGF-basic), Human | - | Refer to Cat. # RC215-13 | >96% |
GHK | - | GHK.HCl | 98% |
Hexapeptide-11 | 100684-36-4 | FVAPFP | 98% |
Hexapeptide-12 | - | VGVAPG | 98% |
Hexapeptide-2 (Nonapeptide-1) | - | MP(dF)R(dW)FKPV-[CONH2] | 98% |
Hexapeptide-9 | 1228371-11-6 | GPQGPQ | 98% |
HGG | - | HGG | 98% |
Kyotorphin | - | YR | 98% |
LL37, Human | - | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | 98% |
Lysine peptide (Ac-RFAAKAA-OH) | - | (Ac)-RFAAKAA-[OH] | 98% |
LZ1 peptide | - | VKRWKKWWRKWKKWV-[NH2] | 98% |
LZ1 peptide | - | VKRWKKWWRKWKKWV-[NH2] | 98% |
N-Acetyl Carnosine | - | (Ac)-[Beta]-AH-[OH] | 98% |
Octapeptide-2 | - | TAEEHEVM-(CONH2) | 98% |
Oligopeptide-20 | - | [H]-CRKIPNGYDTL-[OH] | 98% |
Oligopeptide-20, Human | 124861-55-8 | - | 98% |
Pal-GQPR | 221227-05-0 | (Pal)-GQPR | 98% |
Pal-KTTK | - | (Pal)-KTTK | 98% |
Pal-KV-Dab-T-OH | - | (Pal)-KV-(Dab)-T-[OH] | 98% |
Palmiotyl Tripeptide-5 (Pal-KVK) | 623172-55-4 | (Pal)-KVK-[OH] | 98% |
Palmitoyl Hexapeptide | 171263-26-6 | (Pal)-VGVAPG | 98% |
Palmitoyl Pentapeptide (PAL-KTTKS) | 214047-00-4 | (Pal)-KTTKS | 98% |
Palmitoyl-Carnosine | - | (Pal)-Carnosine | 98% |
Palmitoyl-Dipeptide-6 | - | (Pal)-KV-(Dab)-T-[OH] | 98% |
147732-56-7 | (Pal)-GHK | 98% | |
Palmitoyl Tetrapeptide-3 (Pal-GQPR) | - | (Pal)-GQPR | 98% |
Palmitoyl-Tripeptide | - | (Pal)-RFK | 98% |
Palmitoyl-Tripeptide-3 | - | (Pal)-AHK | 98% |
Pentapeptide-18 (Leuphasyl) | 64963-01-5 | [H]-Y-[D-Ala]-GFL-[OH] | 98% |
Pentapeptide-3 (Vialox) | 725232-44-0 | [H]-GPRPA-[NH2] | 98% |
Peptide CK | - | RKR | 98% |
Peptide CK+ | - | (Ac)-RKR-[NH2] | 98% |
Peptide E | - | RSRK | 98% |
RKR | - | RKR | 98% |
SIKVAV | 146439-94-3 | SIKVAV | 98% |
Snake trippetide (Dipeptide Diaminobutyroyl Benzylamide Diacetate) |
823202-99-9 | [Beta]-AP-(Dab)-[NH]-(Bzl).2AcOH | 98% |
Snap-8 (Acetyl Glutamyl Octapeptide-3) | 868844-74-0 | (Ac)-EEMQRRAD-[NH2] | 98% |
Tripeptide-1 | - | [H]-GHK-[OH] | 98% |
Tripeptide-3 | 725232-44-0 | AHK.HCl | 98% |
(More peptides available than listed above. Please inquire at peptide@biobasic.com; Peptides are for research use only).
Pricing subject to change. Pricing displayed below is for budgeting purposes only. Please inquire for more accurate pricing.